PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G76890.2
Common NameAT-GT2, F7O12.6, GT2, GT-2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Trihelix
Protein Properties Length: 575aa    MW: 65837.2 Da    PI: 6.7687
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G76890.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.55e-3041125187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW++ e+laL+++r+em++++r++ lk+plWee+s+km+e g++rs+k+Ckek+en+ k++k++keg+ ++++++  t+++f++lea
  AT1G76890.2  41 RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMMELGYKRSSKKCKEKFENVYKYHKRTKEGRTGKSEGK--TYRFFEELEA 125
                  8********************************************************************975544..6******985 PP

2trihelix108.83.5e-34397482187
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                  rW+k ev aLi++r+++e +++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr + +s+tcpyf+qlea
  AT1G76890.2 397 RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKYFKKVKESNKKR-PLDSKTCPYFHQLEA 482
                  8*********************************************************************8.9************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.08638100IPR001005SANT/Myb domain
PROSITE profilePS500907.0734098IPR017877Myb-like domain
PfamPF138375.1E-2040125No hitNo description
CDDcd122039.56E-2540105No hitNo description
PROSITE profilePS500907.526390454IPR017877Myb-like domain
SMARTSM007179.2E-4394456IPR001005SANT/Myb domain
PfamPF138377.1E-24396483No hitNo description
CDDcd122033.02E-26396461No hitNo description
Gene3DG3DSA:1.10.10.602.7E-4396453IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001185developmental stageplant embryo globular stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MSGNSEGLLE SSGGGVGGSV EEEKDMKMEE TGEGAGSGGN RWPRPETLAL LRIRSEMDKA  60
FRDSTLKAPL WEEISRKMME LGYKRSSKKC KEKFENVYKY HKRTKEGRTG KSEGKTYRFF  120
EELEAFETLS SYQPEPESQP AKSSAVITNA PATSSLIPWI SSSNPSTEKS SSPLKHHHQV  180
SVQPITTNPT FLAKQPSSTT PFPFYSSNNT TTVSQPPISN DLMNNVSSLN LFSSSTSSST  240
ASDEEEDHHQ VKSSRKKRKY WKGLFTKLTK ELMEKQEKMQ KRFLETLEYR EKERISREEA  300
WRVQEIGRIN REHETLIHER SNAAAKDAAI ISFLHKISGG QPQQPQQHNH KPSQRKQYQS  360
DHSITFESKE PRAVLLDTTI KMGNYDNNHS VSPSSSRWPK TEVEALIRIR KNLEANYQEN  420
GTKGPLWEEI SAGMRRLGYN RSAKRCKEKW ENINKYFKKV KESNKKRPLD SKTCPYFHQL  480
EALYNERNKS GAMPLPLPLM VTPQRQLLLS QETQTEFETD QREKVGDKED EEEGESEEDE  540
YDEEEEGEGD NETSEFEIVL NKTSSPMDIN NNLFT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18391KRSSKKCKE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.250990.0root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible256332_at0.0
Expression AtlasAT1G76890-
AtGenExpressAT1G76890-
ATTED-IIAT1G76890-
Functional Description ? help Back to Top
Source Description
TAIRencodes a plant trihelix DNA-binding protein
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G76890.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G76890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0303630.0BT030363.1 Arabidopsis thaliana At1g76890 mRNA, complete cds.
GenBankX727800.0X72780.1 A.thaliana mRNA for GT-2 factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177815.10.0trihelix transcription factor GT-2
SwissprotQ391170.0TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLD7KTY00.0D7KTY0_ARALL; Putative uncharacterized protein
STRINGAT1G76890.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59952847
Representative plantOGRP6631573
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Ayadi M,Delaporte V,Li YF,Zhou DX
    Analysis of GT-3a identifies a distinct subgroup of trihelix DNA-binding transcription factors in Arabidopsis.
    FEBS Lett., 2004. 562(1-3): p. 147-54
    [PMID:15044016]
  3. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  4. Lam E
    Domain analysis of the plant DNA-binding protein GT1a: requirement of four putative alpha-helices for DNA binding and identification of a novel oligomerization region.
    Mol. Cell. Biol., 1995. 15(2): p. 1014-20
    [PMID:7823917]
  5. Kuhn RM,Caspar T,Dehesh K,Quail PH
    DNA binding factor GT-2 from Arabidopsis.
    Plant Mol. Biol., 1993. 23(2): p. 337-48
    [PMID:8219069]
  6. Smalle J, et al.
    The trihelix DNA-binding motif in higher plants is not restricted to the transcription factors GT-1 and GT-2.
    Proc. Natl. Acad. Sci. U.S.A., 1998. 95(6): p. 3318-22
    [PMID:9501260]